PTM Viewer PTM Viewer

AT4G12860.1

Arabidopsis thaliana [ath]

EF hand calcium-binding protein family

No PTMs currently found

PLAZA: AT4G12860
Gene Family: HOM05D000135
Other Names: unfertilized embryo sac 14; UNE14

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 152

MDRGELSRVFQMFDKNGDGKIAKNELKDFFKSVGIMVPENEINEMIAKMDVNGDGAMDIDEFGSLYQEMVEEKEEEEDMREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLEDCKKMISKVDVDGDGMVNFKEFKQMMRGGGFAALSSN

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002048 1 72
74 147
Sites
Show Type Position
Active Site 14
Active Site 16
Active Site 18
Active Site 20
Active Site 25
Active Site 50
Active Site 52
Active Site 54
Active Site 61
Active Site 87
Active Site 89
Active Site 91
Active Site 98
Active Site 125
Active Site 127
Active Site 129
Active Site 131
Active Site 136

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here